Recombinant human COMP

Recombinant human COMPRecombinant human COMP (Cartilage Oligomeric Matrix Protein) - rhCOMP - is a full-length protein produced in mammalian cells. The protein is designated to be used as a protein standard in immunoanalytical assays.

 

Pricelist

Product quantityCatalogue numberPrice (VAT excluded)
rhCOMP, 25 µg40112 565 Kč
rhCOMP, 100 µg40126 840 Kč

 

Order and delivery

Recombinant human COMP can be ordered via e-mail address . In the purchase order please specify the catalogue number and product quantity.

The protein is delivered on dry ice. The exact delivery term will be specified upon request. For further information please contact us at or on +420 495 056 234, +420 495 056 253.

 

Product details

Protein name:Cartilage Oligomeric Matrix Protein
Other names:Thrombospondin-5
Species:Homo sapiens
Gene ID:1311
GeneBank accession No.:NM_000095
UniProt accession No.:P49747
Function:COMP is important in maintenance of the structural integrity of cartilage via its interactions with other proteins such as collagens and fibronectin.
Sequence:DAAQPARRAVRSFCVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQ
DVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGV
ACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPP
GYSGPTHQGVGLAFAKANKQVCTDINECETGQHNCVPNSVCINTRGSFQCGPCQP
GFVGDQASGCQRRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAVGWAGNGIL
CGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGD
GVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDAC
DDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQADVDHDF
VGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGV
PDSRDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDF
RAFQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKA
VKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQV
GYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPED
YETARGGPEQKLISEEDLNSAVDHHHHHH
Protein length:Full-length recombinant protein, 784 amino acids
Label:c-myc epitope, 6x His tag (C-end)
Mw:86 kDa
Host:CHO cells
Form:Non-purified, diluted in culture medium
Quality control test:ELISA, SDS-PAGE
Storage:-20 °C
Shipping:Frozen on ice